Recombinant Human GRIP1 Protein, GST-tagged

• Cat.No.: GRIP1-12H
• Product Overview: Recombinant Human GRIP1(851 a.a. - 950 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: This gene encodes a member of the glutamate receptor interacting protein family. The encoded scaffold protein binds to and mediates the trafficking and membrane organization of a number of transmembrane proteins. Alternatively spliced transcript variants encoding different isoforms have been described.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• Protein length: 851 a.a. - 950 a.a.
• AA Sequence: QSGILRELEATIMSGSTMSLNHEAPTPRSQLGRQASFQERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKEIMSPTPVELHKVTLYKDSDMEDFG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: GRIP1 glutamate receptor interacting protein 1 [ Homo sapiens ]
• Official Symbol: GRIP1
• Synonyms: GRIP1; glutamate receptor interacting protein 1; glutamate receptor-interacting protein 1; GRIP
• Gene ID: 23426
• mRNA Refseq: NM_001178074
• Protein Refseq: NP_001171545
• MIM: 604597
• UniProt ID: Q9Y3R0