Recombinant Human GRIP1 Protein, GST-tagged

Cat.No. : GRIP1-12H
Product Overview : Recombinant Human GRIP1(851 a.a. - 950 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 851 a.a. - 950 a.a.
Description : This gene encodes a member of the glutamate receptor interacting protein family. The encoded scaffold protein binds to and mediates the trafficking and membrane organization of a number of transmembrane proteins. Alternatively spliced transcript variants encoding different isoforms have been described.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : QSGILRELEATIMSGSTMSLNHEAPTPRSQLGRQASFQERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKEIMSPTPVELHKVTLYKDSDMEDFG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name GRIP1 glutamate receptor interacting protein 1 [ Homo sapiens ]
Official Symbol GRIP1
Synonyms GRIP1; glutamate receptor interacting protein 1; glutamate receptor-interacting protein 1; GRIP;
Gene ID 23426
mRNA Refseq NM_001178074
Protein Refseq NP_001171545
MIM 604597
UniProt ID Q9Y3R0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GRIP1 Products

Required fields are marked with *

My Review for All GRIP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon