Recombinant Human GRIN1 protein, His-tagged
Cat.No. : | GRIN1-2993H |
Product Overview : | Recombinant Human GRIN1 protein(Q05586)(834-938aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 834-938aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.0 kDa |
AA Sequence : | IAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GRIN1 glutamate receptor, ionotropic, N-methyl D-aspartate 1 [ Homo sapiens ] |
Official Symbol | GRIN1 |
Synonyms | GRIN1; glutamate receptor, ionotropic, N-methyl D-aspartate 1; NMDAR1; glutamate [NMDA] receptor subunit zeta-1; GluN1; NMD-R1; glutamate [NMDA] receptor subunit zeta 1; N-methyl-D-aspartate receptor subunit NR1; N-methyl-D-aspartate receptor channel, subunit zeta-1; NR1; MRD8; NMDA1; |
Gene ID | 2902 |
mRNA Refseq | NM_000832 |
Protein Refseq | NP_000823 |
MIM | 138249 |
UniProt ID | Q05586 |
◆ Recombinant Proteins | ||
GRIN1-7102C | Recombinant Chicken GRIN1 | +Inquiry |
GRIN1-6404H | Recombinant Human GRIN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GRIN1-5344H | Recombinant Human GRIN1 Protein, GST-tagged | +Inquiry |
GRIN1-5664HF | Recombinant Full Length Human GRIN1 Protein | +Inquiry |
Grin1-1064M | Recombinant Mouse Grin1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRIN1-5745HCL | Recombinant Human GRIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRIN1 Products
Required fields are marked with *
My Review for All GRIN1 Products
Required fields are marked with *
0
Inquiry Basket