Recombinant Human GRIN1 protein, His-tagged

• Cat.No.: GRIN1-2993H
• Product Overview: Recombinant Human GRIN1 protein(Q05586)(834-938aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 834-938aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.0 kDa
• AA Sequence: IAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: GRIN1 glutamate receptor, ionotropic, N-methyl D-aspartate 1 [ Homo sapiens ]
• Official Symbol: GRIN1
• Synonyms: GRIN1; glutamate receptor, ionotropic, N-methyl D-aspartate 1; NMDAR1; glutamate [NMDA] receptor subunit zeta-1; GluN1; NMD-R1; glutamate [NMDA] receptor subunit zeta 1; N-methyl-D-aspartate receptor subunit NR1; N-methyl-D-aspartate receptor channel, subunit zeta-1; NR1; MRD8; NMDA1
• Gene ID: 2902
• mRNA Refseq: NM_000832
• Protein Refseq: NP_000823
• MIM: 138249
• UniProt ID: Q05586