Recombinant Human GRIA3 protein(741-810 aa), C-His-tagged

Cat.No. : GRIA3-2761H
Product Overview : Recombinant Human GRIA3 protein(P42263)(741-810 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 741-810 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : NEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGG
Gene Name GRIA3 glutamate receptor, ionotropic, AMPA 3 [ Homo sapiens ]
Official Symbol GRIA3
Synonyms GRIA3; glutamate receptor, ionotropic, AMPA 3; GLUR3, glutamate receptor, ionotrophic, AMPA 3; glutamate receptor 3; GluA3; GLURC; MRX94; gluR-3; dJ1171F9.1; glutamate receptor C; glutamate receptor subunit 3; AMPA-selective glutamate receptor 3; glutamate receptor, ionotrophic, AMPA 3; GLUR3; GLUR-C; GLUR-K3;
Gene ID 2892
mRNA Refseq NM_000828
Protein Refseq NP_000819
MIM 305915
UniProt ID P42263

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GRIA3 Products

Required fields are marked with *

My Review for All GRIA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon