Recombinant Human GRIA3 protein(741-810 aa), C-His-tagged

• Cat.No.: GRIA3-2761H
• Product Overview: Recombinant Human GRIA3 protein(P42263)(741-810 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 741-810 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: NEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGG
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: GRIA3 glutamate receptor, ionotropic, AMPA 3 [ Homo sapiens ]
• Official Symbol: GRIA3
• Synonyms: GRIA3; glutamate receptor, ionotropic, AMPA 3; GLUR3, glutamate receptor, ionotrophic, AMPA 3; glutamate receptor 3; GluA3; GLURC; MRX94; gluR-3; dJ1171F9.1; glutamate receptor C; glutamate receptor subunit 3; AMPA-selective glutamate receptor 3; glutamate receptor, ionotrophic, AMPA 3; GLUR3; GLUR-C; GLUR-K3
• Gene ID: 2892
• mRNA Refseq: NM_000828
• Protein Refseq: NP_000819
• MIM: 305915
• UniProt ID: P42263