Recombinant Human GRB14 Protein, GST-tagged

• Cat.No.: GRB14-5037H
• Product Overview: Human GRB14 partial ORF ( NP_004481, 25 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. This protein likely has an inhibitory effect on receptor tyrosine kinase signaling and, in particular, on insulin receptor signaling. This gene may play a role in signaling pathways that regulate growth and metabolism. Transcript variants have been reported for this gene, but their full-length natures have not been determined to date. [provided by RefSeq
• Molecular Mass: 36.74 kDa
• AA Sequence: QVCGAAQGRGDAHDLAPAPWLHARALLPLPDGTRGCAADRRKKKDLDVPEMPSIPNPFPELCCSPITSVLSADLFPKANSRKKQVIKVYSEDETSRALDV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GRB14 growth factor receptor-bound protein 14 [ Homo sapiens ]
• Official Symbol: GRB14
• Synonyms: GRB14; growth factor receptor-bound protein 14; GRB14 adapter protein
• Gene ID: 2888
• mRNA Refseq: NM_004490
• Protein Refseq: NP_004481
• MIM: 601524
• UniProt ID: Q14449