Recombinant Human GRAP2 Protein, GST-tagged

• Cat.No.: GRAP2-5033H
• Product Overview: Human GRAP2 full-length ORF ( NP_004801.1, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Transcript variants utilizing alternative polyA sites exist. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 64.3 kDa
• AA Sequence: MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GRAP2 GRB2-related adaptor protein 2 [ Homo sapiens ]
• Official Symbol: GRAP2
• Synonyms: GRAP2; GRB2-related adaptor protein 2; GRB2-related adapter protein 2; GADS; GRBLG; GrbX; Grf40; Mona; grf-40; GRB-2-like protein; adapter protein GRID; grf40 adapter protein; SH3-SH2-SH3 adapter Mona; SH3-SH2-SH3 adaptor molecule; growth factor receptor-binding protein; GRB2-related protein with insert domain; hematopoietic cell-associated adapter protein GrpL; hematopoietic cell-associated adaptor protein GRPL; growth factor receptor-bound protein 2-related adaptor protein 2; P38; GRID; GRPL; GRB2L; GRAP-2
• Gene ID: 9402
• mRNA Refseq: NM_004810
• Protein Refseq: NP_004801
• MIM: 604518
• UniProt ID: O75791