Recombinant Human GPRC5D Protein, GST-tagged

• Cat.No.: GPRC5D-5291H
• Product Overview: Human GPRC5D partial ORF ( NP_061124, 261 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the G protein-coupled receptor family; however, the specific function of this gene has not yet been determined. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.09 kDa
• AA Sequence: ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPRC5D G protein-coupled receptor, family C, group 5, member D [ Homo sapiens ]
• Official Symbol: GPRC5D
• Synonyms: GPRC5D; G protein-coupled receptor, family C, group 5, member D; G-protein coupled receptor family C group 5 member D; orphan G-protein coupled receptor; MGC129713; MGC129714
• Gene ID: 55507
• mRNA Refseq: NM_018654
• Protein Refseq: NP_061124
• MIM: 607437
• UniProt ID: Q9NZD1