Recombinant Human GPRC5C Protein, GST-tagged

• Cat.No.: GPRC5C-5289H
• Product Overview: Human GPRC5C partial ORF ( NP_071319, 387 a.a. - 486 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The specific function of this protein is unknown; however, this protein may mediate the cellular effects of retinoic acid on the G protein signal transduction cascade. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: AFSMDEPVAAKRPVSPYSGYNGQLLTSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRNPYVWD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPRC5C G protein-coupled receptor, family C, group 5, member C [ Homo sapiens ]
• Official Symbol: GPRC5C
• Synonyms: GPRC5C; G protein-coupled receptor, family C, group 5, member C; G-protein coupled receptor family C group 5 member C; RAIG 3; orphan G-protein coupled receptor; retinoic acid-induced gene 3 protein; retinoic acid responsive gene protein; RAIG3; RAIG-3; MGC131820
• Gene ID: 55890
• mRNA Refseq: NM_018653
• Protein Refseq: NP_061123
• MIM: 605949
• UniProt ID: Q9NQ84