Recombinant Human GPRC5C Protein, GST-tagged
Cat.No. : | GPRC5C-5289H |
Product Overview : | Human GPRC5C partial ORF ( NP_071319, 387 a.a. - 486 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The specific function of this protein is unknown; however, this protein may mediate the cellular effects of retinoic acid on the G protein signal transduction cascade. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | AFSMDEPVAAKRPVSPYSGYNGQLLTSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRNPYVWD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPRC5C G protein-coupled receptor, family C, group 5, member C [ Homo sapiens ] |
Official Symbol | GPRC5C |
Synonyms | GPRC5C; G protein-coupled receptor, family C, group 5, member C; G-protein coupled receptor family C group 5 member C; RAIG 3; orphan G-protein coupled receptor; retinoic acid-induced gene 3 protein; retinoic acid responsive gene protein; RAIG3; RAIG-3; MGC131820; |
Gene ID | 55890 |
mRNA Refseq | NM_018653 |
Protein Refseq | NP_061123 |
MIM | 605949 |
UniProt ID | Q9NQ84 |
◆ Cell & Tissue Lysates | ||
GPRC5C-748HCL | Recombinant Human GPRC5C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPRC5C Products
Required fields are marked with *
My Review for All GPRC5C Products
Required fields are marked with *
0
Inquiry Basket