Recombinant Human GPR89B Protein, GST-tagged
Cat.No. : | GPR89B-5276H |
Product Overview : | Human GPR89 partial ORF ( AAH03187, 175 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GPR89B (G Protein-Coupled Receptor 89B) is a Protein Coding gene. GO annotations related to this gene include signal transducer activity and voltage-gated anion channel activity. An important paralog of this gene is GPR89A. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | SYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKTFKGK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPR89B G protein-coupled receptor 89B [ Homo sapiens ] |
Official Symbol | GPR89B |
Synonyms | GPR89B; G protein-coupled receptor 89B; UNQ192; |
Gene ID | 51463 |
mRNA Refseq | NM_001350180 |
Protein Refseq | NP_001337109 |
MIM | 612806 |
UniProt ID | P0CG08 |
◆ Recombinant Proteins | ||
GPR89B-2490C | Recombinant Chicken GPR89B | +Inquiry |
GPR89B-1961R | Recombinant Rhesus monkey GPR89B Protein, His-tagged | +Inquiry |
GPR89B-1782R | Recombinant Rhesus Macaque GPR89B Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR89B-5276H | Recombinant Human GPR89B Protein, GST-tagged | +Inquiry |
GPR89B-5277H | Recombinant Human GPR89B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR89B-5773HCL | Recombinant Human GPR89B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR89B Products
Required fields are marked with *
My Review for All GPR89B Products
Required fields are marked with *
0
Inquiry Basket