Recombinant Human GPR89B Protein, GST-tagged

• Cat.No.: GPR89B-5276H
• Product Overview: Human GPR89 partial ORF ( AAH03187, 175 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GPR89B (G Protein-Coupled Receptor 89B) is a Protein Coding gene. GO annotations related to this gene include signal transducer activity and voltage-gated anion channel activity. An important paralog of this gene is GPR89A.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.84 kDa
• AA Sequence: SYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKTFKGK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPR89B G protein-coupled receptor 89B [ Homo sapiens ]
• Official Symbol: GPR89B
• Synonyms: GPR89B; G protein-coupled receptor 89B; UNQ192
• Gene ID: 51463
• mRNA Refseq: NM_001350180
• Protein Refseq: NP_001337109
• MIM: 612806
• UniProt ID: P0CG08