Recombinant Human GPR37L1 Protein, GST-tagged

• Cat.No.: GPR37L1-5239H
• Product Overview: Human GPR37L1 partial ORF ( NP_004758, 27 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GPR37L1 (G Protein-Coupled Receptor 37 Like 1) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors and Signaling by GPCR. GO annotations related to this gene include G-protein coupled receptor activity and G-protein coupled peptide receptor activity. An important paralog of this gene is GPR37.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.18 kDa
• AA Sequence: PLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATSPNPDKDGGTPDSGQELRGNLTGAPGQRLQIQNPLYPVTESSYSA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPR37L1 G protein-coupled receptor 37 like 1 [ Homo sapiens ]
• Official Symbol: GPR37L1
• Synonyms: GPR37L1; G protein-coupled receptor 37 like 1; endothelin B receptor-like protein 2; ETBR LP 2; G-protein coupled receptor 37 like 1; G-protein coupled receptor 37-like 1; endothelin type b receptor-like protein 2; ETBR-LP-2; ET(B)R-LP-2
• Gene ID: 9283
• mRNA Refseq: NM_004767
• Protein Refseq: NP_004758
• MIM: 617630
• UniProt ID: O60883