Recombinant Human GPR35 Full Length Transmembrane protein, His-tagged
Cat.No. : | GPR35-1484H |
Product Overview : | Recombinant Human GPR35 protein(Q9HC97)(1-309aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-309aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.9 kDa |
AA Sequence : | MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMTNLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVRLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GPR35 G protein-coupled receptor 35 [ Homo sapiens ] |
Official Symbol | GPR35 |
Synonyms | GPR35; G protein-coupled receptor 35; G-protein coupled receptor 35; KYNA receptor; kynurenic acid receptor; |
Gene ID | 2859 |
mRNA Refseq | NM_001195381 |
Protein Refseq | NP_001182310 |
MIM | 602646 |
UniProt ID | Q9HC97 |
◆ Recombinant Proteins | ||
GPR35-3066H | Recombinant Human GPR35 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR35-1484H | Recombinant Human GPR35 Full Length Transmembrane protein, His-tagged | +Inquiry |
GPR35-603H | Recombinant Human GPR35 | +Inquiry |
GPR35-2890H | Recombinant Human GPR35 Protein (Arg240-Ala309), N-GST tagged | +Inquiry |
RFL28295HF | Recombinant Full Length Human G-Protein Coupled Receptor 35(Gpr35) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR35 Products
Required fields are marked with *
My Review for All GPR35 Products
Required fields are marked with *
0
Inquiry Basket