Recombinant Human GPR34 Protein, GST-tagged
Cat.No. : | GPR34-5235H |
Product Overview : | Human GPR34 full-length ORF ( NP_005291.1, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | G protein-coupled receptors (GPCRs), such as GPR34, are integral membrane proteins containing 7 putative transmembrane domains (TMs). These proteins mediate signals to the interior of the cell via activation of heterotrimeric G proteins that in turn activate various effector proteins, ultimately resulting in a physiologic response.[supplied by OMIM |
Molecular Mass : | 70.3 kDa |
AA Sequence : | MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTSYSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKWTLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWMLALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLHDTSVAVKIQSSSKST |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPR34 G protein-coupled receptor 34 [ Homo sapiens ] |
Official Symbol | GPR34 |
Synonyms | GPR34; G protein-coupled receptor 34; probable G-protein coupled receptor 34; |
Gene ID | 2857 |
mRNA Refseq | NM_001097579 |
Protein Refseq | NP_001091048 |
MIM | 300241 |
UniProt ID | Q9UPC5 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR34 Products
Required fields are marked with *
My Review for All GPR34 Products
Required fields are marked with *
0
Inquiry Basket