Recombinant Human GPR32 Protein, GST-tagged

• Cat.No.: GPR32-5233H
• Product Overview: Human GPR32 full-length ORF (AAH67454.1, 1 a.a. - 356 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is intronless and encodes a member of the G-protein coupled receptor 1 family. The encoded protein binds to resolvin D1 and lipoxin A4 and has been linked to pulmonary inflammation. A related pseudogene has been identified on chromosome 19. [provided by RefSeq, Nov 2012]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 65.56 kDa
• AA Sequence: MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLGNGLVLWMTVFRMARTVSTVCFFHLALADFMLSLSLPIAMYYIVSRQWLLGEWACKLYITFVFLSYFASNCLLVFISVDRCISVLYPVWALNHRTVQRASWLAFGVWLLAAALCSAHLKFRTTRKWNGCTHCYLAFNSDNETAQIWIEGVVEGHIIGTIGHFLLGFLGPLAIIGTCAHLIRAKLLREGWVHANRPKRLLLVLVSAFFIFWSPFNVVLLVHLWRRVMLKEIYHPRMLLILQASFALGCVNSSLNPFLYVFVGRDFQEKFFQSLTSALARAFGEEEFLSSCPRGNAPRE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPR32 G protein-coupled receptor 32 [ Homo sapiens ]
• Official Symbol: GPR32
• Synonyms: GPR32; G protein-coupled receptor 32; probable G-protein coupled receptor 32
• Gene ID: 2854
• mRNA Refseq: NM_001506
• Protein Refseq: NP_001497
• MIM: 603195
• UniProt ID: O75388