Recombinant Human GPR182 Protein, GST-tagged

• Cat.No.: GPR182-364H
• Product Overview: Human ADMR partial ORF ( NP_009195, 1 a.a. - 54 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Adrenomedullin is a potent vasodilator peptide that exerts major effects on cardiovascular function. This gene encodes a seven-transmembrane protein that belongs to the family 1 of G-protein coupled receptors. Studies of the rat counterpart suggest that the encoded protein may function as a receptor for adrenomedullin. [provided by RefSeq, Jul 2008]
• Molecular Mass: 31.68 kDa
• AA Sequence: MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPR182 G protein-coupled receptor 182 [ Homo sapiens ]
• Official Symbol: GPR182
• Synonyms: GPR182; G protein-coupled receptor 182; ADMR, adrenomedullin receptor; G-protein coupled receptor 182; AM R; G10D; hrhAMR; adrenomedullin receptor; AMR; 7TMR; ADMR; AM-R; gamrh; MGC34399
• Gene ID: 11318
• mRNA Refseq: NM_007264
• Protein Refseq: NP_009195
• MIM: 605307
• UniProt ID: O15218