Description :	Adrenomedullin is a potent vasodilator peptide that exerts major effects on cardiovascular function. This gene encodes a seven-transmembrane protein that belongs to the family 1 of G-protein coupled receptors. Studies of the rat counterpart suggest that the encoded protein may function as a receptor for adrenomedullin. [provided by RefSeq
Source :	Wheat Germ
Species :	Human
Form :	Liquid
Molecular Mass :	45.3 kDa
AA Sequence :	MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALYLAMFVVGLVENLLVICVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWLWGSFSCRFTHYFYFVNMYSSIFFLVCLSVDRYVTLTSASPSWQRYQHRVRRAMCAGIWVLSAIIPLPEVVHIQLVEGPEPMCLFMAPFETYSTWALAVALSTTILGFLLPFPLITVFNVLTACRLRQPGQPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYFFYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS
Applications :	Antibody Production Functional Study Compound Screening
Usage :	Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Tag :	Non

Gene Name	GPR182 G protein-coupled receptor 182 [ Homo sapiens ]
Official Symbol	GPR182
Synonyms	GPR182; G protein-coupled receptor 182; ADMR, adrenomedullin receptor; G-protein coupled receptor 182; AM R; G10D; hrhAMR; adrenomedullin receptor; AMR; 7TMR; ADMR; AM-R; gamrh; MGC34399;
Gene ID	11318
mRNA Refseq	NM_007264
Protein Refseq	NP_009195
MIM	605307
UniProt ID	O15218

ACE2-735H	Recombinant Human ACE2 Protein, His-tagged	+Inquiry
FGF10-15H	Active Recombinant Human FGF10 protein	+Inquiry
KITLG-19H	Active Recombinant Human KITLG Protein, Pre-aliquoted	+Inquiry
DEFB1-17H	Active Recombinant Human DEFB1 protein(1-47aa)	+Inquiry
DEFB4-18H	Active Recombinant Human DEFB4 protein(1-50aa)	+Inquiry