Recombinant Human GPR180 Protein, GST-tagged

• Cat.No.: GPR180-4944H
• Product Overview: Human ITR partial ORF ( NP_851320.1, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein that is a member of the G protein-coupled receptor superfamily. This protein is produced predominantly in vascular smooth muscle cells and may play an important role in the regulation of vascular remodeling. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: QGKTLRGSFSSTAAQDAQGQRIGHFEFHGDHALLCVRINNIAVAVGKEAKLYLFQAQEWLKLQQSSHGYSCSEKLSKAQLTMTMNQTEHNLTVSQIPSPQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPR180 G protein-coupled receptor 180 [ Homo sapiens ]
• Official Symbol: GPR180
• Synonyms: GPR180; G protein-coupled receptor 180; integral membrane protein GPR180; intimal thickness related receptor; ITR; intimal thickness-related receptor; DKFZp586C1322; DKFZp667K0825
• Gene ID: 160897
• mRNA Refseq: NM_180989
• Protein Refseq: NP_851320
• MIM: 607787
• UniProt ID: Q86V85