Recombinant Human GPR141 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GPR141-2091H
• Product Overview: GPR141 MS Standard C13 and N15-labeled recombinant protein (NP_861456) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: GPR141 is a member of the rhodopsin family of G protein-coupled receptors (GPRs).
• Molecular Mass: 35.3 kDa
• AA Sequence: MPGHNTSRNSSCDPIVTPHLISLYFIVLIGGLVGVISILFLLVKMNTRSVTTMAVINLVVVHSVFLLTVPFRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKCKDKVEFYRKLHAVAASAGMWTLVIVIVVPLVVSRYGIHEEYNEEHCFKFHKELAYTYVKIINYMIVIFVIAVAVILLVFQVFIIMLMVQKLRHSLLSHQEFWAQLKNLFFIGVILVCFLPYQFFRIYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDLLLFVFGGSHWFKQKIIGLWNCVLCRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GPR141 G protein-coupled receptor 141 [ Homo sapiens (human) ]
• Official Symbol: GPR141
• Synonyms: GPR141; G protein-coupled receptor 141; PGR13; probable G-protein coupled receptor 141; G-protein coupled receptor PGR13
• Gene ID: 353345
• mRNA Refseq: NM_181791
• Protein Refseq: NP_861456
• MIM: 609045
• UniProt ID: Q7Z602