Recombinant Human GPR108 Protein

• Cat.No.: GPR108-5561HF
• Product Overview: Human GPR108 ORF (ENSP00000264080) recombinant protein without tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 208-301 a.a.
• Description: GPR108 (G Protein-Coupled Receptor 108) is a Protein Coding gene. An important paralog of this gene is GPR107.
• Form: Liquid
• Molecular Mass: 10.9 kDa
• AA Sequence: MVICYVYFTRIIAILLQVAVPFQWQWLYQLLVEGSTLAFFVLTGYKFQPTGNNPYLQLPQEDEEDVQMEQVMTDSGFREGLSKVNKTASGRELL
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: GPR108 G protein-coupled receptor 108 [ Homo sapiens ]
• Official Symbol: GPR108
• Synonyms: LUSTR2; GPR108; G protein-coupled receptor 108
• Gene ID: 56927
• mRNA Refseq: NM_001080452
• Protein Refseq: NP_001073921
• MIM: 618491
• UniProt ID: Q9NPR9