Recombinant Human GPN2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GPN2-5565H
• Product Overview: GPN2 MS Standard C13 and N15-labeled recombinant protein (NP_060536) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: GPN2 (GPN-Loop GTPase 2) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include nucleotide binding and hydrolase activity. An important paralog of this gene is GPN3.
• Molecular Mass: 34.5 kDa
• AA Sequence: MAGAAPTTAFGQAVIGPPGSGKTTYCLGMSEFLRALGRRVAVVNLDPANEGLPYECAVDVGELVGLGDVMDALRLGPNGGLLYCMEYLEANLDWLRAKLDPLRGHYFLFDCPGQVELCTHHGALRSIFSQMAQWDLRLTAVHLVDSHYCTDPAKFISVLCTSLATMLHVELPHINLLSKMDLIEHYGKLAFNLDYYTEVLDLSYLLDHLASDPFFRHYRQLNEKLVRLIEDYSLVSFIPLNIQDKESIQRVLQAVDKANGYCFGAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSNQSVEQEAMQLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GPN2 GPN-loop GTPase 2 [ Homo sapiens (human) ]
• Official Symbol: GPN2
• Synonyms: GPN2; GPN-loop GTPase 2; ATP binding domain 1 family, member B, ATPBD1B; FLJ10349; ATP-binding domain 1 family member B; ATP binding domain 1 family, member B; ATPBD1B
• Gene ID: 54707
• mRNA Refseq: NM_018066
• Protein Refseq: NP_060536
• UniProt ID: Q9H9Y4