Recombinant Human GPLD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GPLD1-1383H
• Product Overview: GPLD1 MS Standard C13 and N15-labeled recombinant protein (NP_803436) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 17.3 kDa
• AA Sequence: MSAFRLWPGLLIMLGSLCHRGSPCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCFYPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQGFLRTMGAIDFHGSYSEAHSAGDFGTVYLHLLNFLVVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GPLD1 glycosylphosphatidylinositol specific phospholipase D1 [ Homo sapiens (human) ]
• Official Symbol: GPLD1
• Synonyms: GPLD1; glycosylphosphatidylinositol specific phospholipase D1; phosphatidylinositol-glycan-specific phospholipase D; GPI-PLD; PI-G PLD; GPI-specific phospholipase D; glycoprotein phospholipase D; phospholipase D, phosphatidylinositol-glycan-specific; glycosylphosphatidylinositol specific phospholipase D1, isoform 2; GPIPLD; PIGPLD; GPIPLDM; PIGPLD1; MGC22590
• Gene ID: 2822
• mRNA Refseq: NM_177483
• Protein Refseq: NP_803436
• MIM: 602515
• UniProt ID: P80108