Recombinant Human GPI, His-tagged

• Cat.No.: GPI-27616TH
• Product Overview: Recombinant fragment, corresponding to amino acids 37-297 of Human Glucose 6 phosphate isomerase with an N terminal His tag. Predicted MWt: 30 kDa

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 37-297 a.a.
• Description: This gene belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. The protein encoded by this gene is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. The protein functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 161 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRG VEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVD GKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDV INIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHI AKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFL QAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWD WVGGRYSLWSAIGLSIALHVGFDNFEQLL
• Sequence Similarities: Belongs to the GPI family.

Gene Information

• Gene Name: GPI glucose-6-phosphate isomerase [ Homo sapiens ]
• Official Symbol: GPI
• Synonyms: GPI; glucose-6-phosphate isomerase; glucose phosphate isomerase; AMF; NLK
• Gene ID: 2821
• mRNA Refseq: NM_000175
• Protein Refseq: NP_000166
• MIM: 172400
• Uniprot ID: P06744
• Chromosome Location: 19q13.1
• Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Gluconeogenesis, organism-specific biosystem; Glucose metabolism, organism-specific biosystem; Glycolysis, organism-specific biosystem
• Function: cytokine activity; glucose-6-phosphate isomerase activity; growth factor activity; isomerase activity