Recombinant Human GPBAR1 protein, GST-tagged

• Cat.No.: GPBAR1-10H
• Product Overview: Recombinant Human GPBAR1(1 a.a. - 330 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1 a.a. - 330 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 62.04 kDa
• AA Sequence: MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLW NQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWT PGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARA QAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: GPBAR1 G protein-coupled bile acid receptor 1 [ Homo sapiens ]
• Official Symbol: GPBAR1
• Synonyms: BG37; TGR5; M-BAR; GPCR19; GPR131
• Gene ID: 151306
• mRNA Refseq: NM_170699.2
• Protein Refseq: NP_733800.1
• MIM: 610147
• UniProt ID: Q8TDU6
• Chromosome Location: 2q35
• Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem;G alpha (s) signalling events, organism-specific biosystem;GPCR downstream signaling, organism-specific biosystem;GPCR ligand binding, organism-specific biosystem;Signal Transduction, organism-specific biosystem;Signaling by GPCR, organism-specific biosystem
• Function: G-protein coupled receptor activity