Recombinant Human GPATCH2 Protein, GST-tagged

• Cat.No.: GPATCH2-5140H
• Product Overview: Human GPATCH2 full-length ORF ( AAH63474.1, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The gene encodes a nuclear factor that may play a role in spermatogenesis and in tumor growth during breast cancer. The encoded protein contains a G-patch domain with an RNA binding motif. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2017]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 69 kDa
• AA Sequence: MFGAAGRQPIGAPAAGNSWHFSRTMEELVHDLVSALEESSEQARGGFAETGDHSRSISCPLKRQARKRRGRKRRSYNVHHPWETGHCLSEGSDSSLEEPSKDYRENHNNNKKDHSDSDDQMLVAKRRPSSNLNNNVRGKRPLWHESDFAVDNVGNRTLRRRRKVKRMAVDLPQDISNKRTMTQPPEGCRDQDMDSDRAYQYQEFTKNKVKKRKLKIIRQAPKIQDEGVVLESEETNQTNKDKMECEEQKVSDELMSESDSSSLSSTDAGLFTNDEGRQGDDEQSDWFYEKESGGACGITGVVPWWEKEDPTELDKNVPDPVFESILTGSFPLMSHPSRRGFQARLSRLHGMSSKNIKKSGGTPTSMATNWTSEIPL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPATCH2 G patch domain containing 2 [ Homo sapiens ]
• Official Symbol: GPATCH2
• Synonyms: GPATCH2; G patch domain containing 2; GPATC2; G patch domain-containing protein 2; cancer/testis antigen 110; CT110; FLJ10252; PPP1R30; protein phosphatase 1; regulatory subunit 30; protein phosphatase 1, regulatory subunit 30; FLJ21048; MGC74998; RP11-361K17.1
• Gene ID: 55105
• mRNA Refseq: NM_018040
• Protein Refseq: NP_060510
• MIM: 616836
• UniProt ID: Q9NW75