Recombinant Human GP1BB Full Length Transmembrane protein (26-206 aa), His-SUMO-Myc-tagged

• Cat.No.: GP1BB-2723H
• Product Overview: Recombinant Human GP1BB Protein (26-206 aa) is produced by in vitro E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal.

Specification

• Source: In vitro E. coli expression system
• Species: Human
• Tag: His&Myc&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39.3 kDa
• Protein length: 26-206aa
• AA Sequence: CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: GP1BB glycoprotein Ib (platelet), beta polypeptide [ Homo sapiens ]
• Official Symbol: GP1BB
• Synonyms: GP1BB; glycoprotein Ib (platelet), beta polypeptide; platelet glycoprotein Ib beta chain; CD42c; GPIb-beta; GP-Ib beta; antigen CD42b-beta; nuclear localization signal deleted in velocardiofacial syndrome; BS; CD42C; GPIBB; BDPLT1
• Gene ID: 2812
• mRNA Refseq: NM_000407
• Protein Refseq: NP_000398
• MIM: 138720
• UniProt ID: P13224