Recombinant Human GOT2 Protein, GST-tagged

• Cat.No.: GOT2-5128H
• Product Overview: Human GOT2 full-length ORF ( AAH00525.1, 1 a.a. - 430 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. [provided by RefSeq
• Molecular Mass: 73.9 kDa
• AA Sequence: MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQATK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GOT2 glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2) [ Homo sapiens ]
• Official Symbol: GOT2
• Synonyms: GOT2; glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2); aspartate aminotransferase, mitochondrial; KAT4; KATIV; kynurenine aminotransferase IV; mitAAT; FABP-1; FABPpm; mAspAT; transaminase A; fatty acid-binding protein; glutamate oxaloacetate transaminase 2; plasma membrane-associated fatty acid-binding protein; FLJ40994
• Gene ID: 2806
• mRNA Refseq: NM_002080
• Protein Refseq: NP_002071
• MIM: 138150
• UniProt ID: P00505