Recombinant Human GOLPH3 Protein, GST-tagged

• Cat.No.: GOLPH3-5113H
• Product Overview: Human GOLPH3 full-length ORF ( NP_071413.1, 1 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a peripheral membrane protein of the Golgi stack and may have a regulatory role in Golgi trafficking. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 60.2 kDa
• AA Sequence: MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GOLPH3 golgi phosphoprotein 3 (coat-protein) [ Homo sapiens ]
• Official Symbol: GOLPH3
• Synonyms: GOLPH3; golgi phosphoprotein 3 (coat-protein); Golgi phosphoprotein 3; coat protein; golgi peripheral membrane protein 1; 34 kDa; golgi protein; golgi associated protein; GOPP1; GPP34; MIDAS; coat-protein; coat protein GPP34; golgi-associated protein; mitochondrial DNA absence factor; golgi peripheral membrane protein 1, 34 kDa; FLJ90675
• Gene ID: 64083
• mRNA Refseq: NM_022130
• Protein Refseq: NP_071413
• MIM: 612207
• UniProt ID: Q9H4A6