Recombinant Human GOLIM4 Protein, GST-tagged

• Cat.No.: GOLIM4-5115H
• Product Overview: Human GOLPH4 partial ORF ( NP_055313, 473 a.a. - 568 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus. [provided by RefSeq
• Molecular Mass: 36.3 kDa
• AA Sequence: HQEQLRQQAHYDAMDNDIVQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHEPREQGPREADPESEADRAAVEDINPADDPNNQGEDEFEEAEQV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GOLIM4 golgi integral membrane protein 4 [ Homo sapiens ]
• Official Symbol: GOLIM4
• Synonyms: GOLIM4; golgi integral membrane protein 4; golgi phosphoprotein 4, GOLPH4; Golgi integral membrane protein 4; GIMPC; GPP130; P138; golgi phosphoprotein 4; type II Golgi membrane protein; golgi phosphoprotein of 130 kDa; golgi integral membrane protein, cis; 130 kDa golgi-localized phosphoprotein; golgi-localized phosphoprotein of 130 kDa; cis Golgi-localized calcium-binding protein; GOLPH4
• Gene ID: 27333
• mRNA Refseq: NM_014498
• Protein Refseq: NP_055313
• MIM: 606805
• UniProt ID: O00461