Recombinant Human GOLGA2, His-tagged

Cat.No. : GOLGA2-29029TH
Product Overview : Recombinant fragment, corresponding to amino acids 318-617 of Human GM130 with N terminal His tag; 300 amino acids, 63kDa. GenBank: EAW87765.1
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 318-617 a.a.
Description : The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes one of the golgins, a family of proteins localized to the Golgi. This encoded protein has been postulated to play roles in the stacking of Golgi cisternae and in vesicular transport. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 121 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids : LGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHL QQYVAAYQQLTSEKEVLHNQLLLQTQLVDQLQQQEAQG KAVAEMARQELQETQERLEAATQQNQQLRAQLSLMAHPGE GDGLDREEEEDEEEEEEEAVAVPQPMPSIPEDLESREA MVAFFNSAVASAEEEQARLRGQLKEQRVRCRRLAHLLA SAQKEPEAAAPAPGTGGDSVCGETHRALQGAMEKLQSRFM ELMQEKADLKERAREGSPRDNPTAQQIMQLLREMQNPR ERPGLGSNPCIPFFYRADENDEVKITVI
Sequence Similarities : Belongs to the GOLGA2 family.
Gene Name GOLGA2 golgin A2 [ Homo sapiens ]
Official Symbol GOLGA2
Synonyms GOLGA2; golgin A2; golgi autoantigen, golgin subfamily a, 2; Golgin subfamily A member 2; GM130; Golgi matrix protein GM130; golgin 95; SY11 protein;
Gene ID 2801
mRNA Refseq NM_004486
Protein Refseq NP_004477
MIM 602580
Uniprot ID Q08379
Chromosome Location 9q34.13
Pathway PLK1 signaling events, organism-specific biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GOLGA2 Products

Required fields are marked with *

My Review for All GOLGA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon