Recombinant Human GNRHR2 Protein, GST-tagged
Cat.No. : | GNRHR2-5100H |
Product Overview : | Human GNRHR2 partial ORF ( NP_001457, 237 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The receptor for gonadotropin releasing hormone 2 (GnRH2) is encoded by the GnRH2 receptor (GnRHR2) gene. In non-hominoid primates and non-mammalian vertebrates, GnRHR2 encodes a seven-transmembrane G-protein coupled receptor. However, in human, the N-terminus of the predicted protein contains a frameshift and premature stop codon. In human, GnRHR2 transcription occurs but whether the gene produces a functional C-terminal multi-transmembrane protein is currently unresolved. Alternative splice variants have been reported. An untranscribed pseudogene of GnRHR2 is also on chromosome 14. [provided by RefSeq |
Molecular Mass : | 31.9 kDa |
AA Sequence : | TLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNRHR2 gonadotropin releasing hormone receptor 2 (pseudogene) [ Homo sapiens (human) ] |
Official Symbol | GNRHR2 |
Synonyms | GNRHR2; gonadotropin releasing hormone receptor 2 (pseudogene); GnRH-II-R; GnRH receptor II 5TM; Type II GnRH receptor; gonadotropin-releasing hormone (type 2) receptor 2, pseudogene |
Gene ID | 114814 |
MIM | 612875 |
UniProt ID | Q96P88 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNRHR2 Products
Required fields are marked with *
My Review for All GNRHR2 Products
Required fields are marked with *
0
Inquiry Basket