Description :	The receptor for gonadotropin releasing hormone 2 (GnRH2) is encoded by the GnRH2 receptor (GnRHR2) gene. In non-hominoid primates and non-mammalian vertebrates, GnRHR2 encodes a seven-transmembrane G-protein coupled receptor. However, in human, the N-terminus of the predicted protein contains a frameshift and premature stop codon. In human, GnRHR2 transcription occurs but whether the gene produces a functional C-terminal multi-transmembrane protein is currently unresolved. Alternative splice variants have been reported. An untranscribed pseudogene of GnRHR2 is also on chromosome 14. [provided by RefSeq
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	31.9 kDa
AA Sequence :	TLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	GNRHR2 gonadotropin releasing hormone receptor 2 (pseudogene) [ Homo sapiens (human) ]
Official Symbol	GNRHR2
Synonyms	GNRHR2; gonadotropin releasing hormone receptor 2 (pseudogene); GnRH-II-R; GnRH receptor II 5TM; Type II GnRH receptor; gonadotropin-releasing hormone (type 2) receptor 2, pseudogene
Gene ID	114814
MIM	612875
UniProt ID	Q96P88