Recombinant Human GNRH2, His-tagged

• Cat.No.: GNRH2-178H
• Product Overview: Recombinant Human Progonadoliberin-2/GNRH2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln24-Val120) of Human GNRH2 fused with a polyhistidine tag at the C-terminus.

Specification

• Source: HEK293
• Species: Human
• Tag: His
• AA Sequence: QHWSHGWYPGGKRALSSAQDPQNALRPPGRALDTAAGSPVQTAHGLPSDALAPLDDSMPWEGRTT AQWSLHRKRHLARTLLTAAREPRPAPPSSNKVVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Protein length: 24-120 a.a.

Gene Information

• Gene Name: GNRH2 gonadotropin-releasing hormone 2 [ Homo sapiens ]
• Official Symbol: GNRH2
• Synonyms: GNRH2; gonadotropin-releasing hormone 2; progonadoliberin-2; luliberin II; progonadoliberin II; luteinizing hormone-releasing hormone II; GnRH-II; LH-RHII
• Gene ID: 2797
• mRNA Refseq: NM_001501
• Protein Refseq: NP_001492
• MIM: 602352
• UniProt ID: O43555
• Chromosome Location: 20p13
• Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GnRH signaling pathway, organism-specific biosystem; GnRH signaling pathway, conserved biosystem; Hormone ligand-binding receptors, organism-specific biosystem
• Function: hormone activity