Recombinant Human GNPDA2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GNPDA2-4679H
• Product Overview: GNPDA2 MS Standard C13 and N15-labeled recombinant protein (NP_612208) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is an allosteric enzyme that catalyzes the reversible reaction converting D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium. Variations of this gene have been reported to be associated with influencing body mass index and susceptibility to obesity. A pseudogene of this gene is located on chromosome 9. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
• Molecular Mass: 30.9 kDa
• AA Sequence: MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVSTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GNPDA2 glucosamine-6-phosphate deaminase 2 [ Homo sapiens (human) ]
• Official Symbol: GNPDA2
• Synonyms: GNPDA2; glucosamine-6-phosphate deaminase 2; glucosamine-6-phosphate isomerase 2; glucosamine 6 phosphate isomerase; SB52; GNPDA 2; 4921523I18Rik; glcN6P deaminase 2; glucosamine-6-phosphate isomerase SB52; putative glucosamine-6-phosphate isomerase; GNP2
• Gene ID: 132789
• mRNA Refseq: NM_138335
• Protein Refseq: NP_612208
• MIM: 613222
• UniProt ID: Q8TDQ7