Recombinant Human GNPDA2 Protein, GST-tagged

• Cat.No.: GNPDA2-5092H
• Product Overview: Human GNPDA2 full-length ORF ( NP_612208.1, 1 a.a. - 276 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is an allosteric enzyme that catalyzes the reversible reaction converting D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium. Variations of this gene have been reported to be associated with influencing body mass index and susceptibility to obesity. A pseudogene of this gene is located on chromosome 9. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 57.5 kDa
• AA Sequence: MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNPDA2 glucosamine-6-phosphate deaminase 2 [ Homo sapiens ]
• Official Symbol: GNPDA2
• Synonyms: GNPDA2; glucosamine-6-phosphate deaminase 2; glucosamine-6-phosphate isomerase 2; glucosamine 6 phosphate isomerase; SB52; GNPDA 2; 4921523I18Rik; glcN6P deaminase 2; glucosamine-6-phosphate isomerase SB52; putative glucosamine-6-phosphate isomerase; GNP2
• Gene ID: 132789
• mRNA Refseq: NM_138335
• Protein Refseq: NP_612208
• MIM: 613222
• UniProt ID: Q8TDQ7