Recombinant Human GNPDA1
Cat.No. : | GNPDA1-28076TH |
Product Overview : | Recombinant full length Human GNPDA1, expressed in Saccharomyces cerevisiae, amino acids 1-289, 33 kDa, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
ProteinLength : | 1-289 a.a. |
Description : | Glucosamine-6-phosphate deaminase (EC 3.5.99.6) is an allosteric enzyme that catalyzes the reversible conversion of D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium (Arreola et al. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLP TGSTPLGCYKKLIEYYKNGDLSFKYVKTFNMDEYVGLP RDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQA ECDAFEEKIKAAGGIELFVGGIGPDGHIAFNEPGSSLVSR TRVKTLAMDTILANARFFDGELTKVPTMALTVGVGTVM DAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQH PRTVFVCDEDATLELKVKTVKY |
Sequence Similarities : | Belongs to the glucosamine/galactosamine-6-phosphate isomerase family. |
Full Length : | Full L. |
Gene Name | GNPDA1 glucosamine-6-phosphate deaminase 1 [ Homo sapiens ] |
Official Symbol | GNPDA1 |
Synonyms | GNPDA1; glucosamine-6-phosphate deaminase 1; glucosamine 6 phosphate isomerase , GNPI; glucosamine-6-phosphate isomerase 1; glucosamine 6 phosphate deaminase; GNPDA; GPI; HLN; KIAA0060; oscillin; |
Gene ID | 10007 |
mRNA Refseq | NM_005471 |
Protein Refseq | NP_005462 |
MIM | 601798 |
Uniprot ID | P46926 |
Chromosome Location | 5q21 |
Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function | glucosamine-6-phosphate deaminase activity; hydrolase activity; |
◆ Recombinant Proteins | ||
TGM3-16716M | Recombinant Mouse TGM3 Protein | +Inquiry |
CDK2-172H | Recombinant Human CDK2 | +Inquiry |
B3GALT1-2446H | Recombinant Human B3GALT1 protein, His-tagged | +Inquiry |
PRKAA1 K45R-01H | Recombinant human 5'-AMP-activated protein kinase catalytic subunit alpha-1 K45R mutant protein, His-tagged | +Inquiry |
LHX9-2468Z | Recombinant Zebrafish LHX9 | +Inquiry |
◆ Native Proteins | ||
Cysteine-01C | Native Clostridium histolyticum Cysteine (C41, heavy chain) | +Inquiry |
MPOC-235H | Active Native Human Myeloperoxidase Isoform C | +Inquiry |
CA2-34R | Native Rabbit Carbonic Anhydrase II (CA2) Protein | +Inquiry |
IgA-242D | Native Dog Immunoglobulin A | +Inquiry |
CXCL1-27707TH | Native Human CXCL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Heart Ventricle-220H | Human Heart Ventricle (LT) Lysate | +Inquiry |
UXT-442HCL | Recombinant Human UXT 293 Cell Lysate | +Inquiry |
Lung-434S | Sheep Lung Lysate, Total Protein | +Inquiry |
DDX28-7011HCL | Recombinant Human DDX28 293 Cell Lysate | +Inquiry |
CD200-2707HCL | Recombinant Human CD200 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNPDA1 Products
Required fields are marked with *
My Review for All GNPDA1 Products
Required fields are marked with *
0
Inquiry Basket