Recombinant Human GNG7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GNG7-6287H
• Product Overview: GNG7 MS Standard C13 and N15-labeled recombinant protein (NP_443079) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Plays a role in the regulation of adenylyl cyclase signaling in certain regions of the brain. Plays a role in the formation or stabilzation of a G protein heterotrimer (G(olf) subunit alpha-beta-gamma-7) that is required for adenylyl cyclase activity in the striatum.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 7.5 kDa
• AA Sequence: MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIILTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GNG7 G protein subunit gamma 7 [ Homo sapiens (human) ]
• Official Symbol: GNG7
• Synonyms: GNG7; guanine nucleotide binding protein (G protein), gamma 7; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7; FLJ00058
• Gene ID: 2788
• mRNA Refseq: NM_052847
• Protein Refseq: NP_443079
• MIM: 604430
• UniProt ID: O60262