Recombinant Human GNG7 Protein, GST-tagged

• Cat.No.: GNG7-5073H
• Product Overview: Human GNG7 full-length ORF ( AAH14466, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: GNG7 (G Protein Subunit Gamma 7) is a Protein Coding gene. Among its related pathways are Aquaporin-mediated transport and Immune response CCR3 signaling in eosinophils. GO annotations related to this gene include signal transducer activity. An important paralog of this gene is GNG12.
• Molecular Mass: 33.22 kDa
• AA Sequence: MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNG7 guanine nucleotide binding protein (G protein), gamma 7 [ Homo sapiens ]
• Official Symbol: GNG7
• Synonyms: GNG7; guanine nucleotide binding protein (G protein), gamma 7; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7; FLJ00058
• Gene ID: 2788
• mRNA Refseq: NM_052847
• Protein Refseq: NP_443079
• MIM: 604430
• UniProt ID: O60262