Recombinant Human GNG3 Protein, GST-tagged

• Cat.No.: GNG3-5069H
• Product Overview: Human GNG3 full-length ORF ( AAH15563, 1 a.a. - 75 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: G proteins are heterotrimers of alpha, beta, and gamma subunits. Gamma subunits, such as GNG3, contribute to the specificity of the hundreds of receptor signaling pathways involving G proteins (Schwindinger et al., 2004 [PubMed 15314181]).
• Molecular Mass: 33.99 kDa
• AA Sequence: MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLVTYCDAHACEDPLITPVPTSENPFREKKFFCALL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNG3 guanine nucleotide binding protein (G protein), gamma 3 [ Homo sapiens ]
• Official Symbol: GNG3
• Synonyms: GNG3; guanine nucleotide binding protein (G protein), gamma 3; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3; guanine nucleotide binding protein gamma 3 subunit; NBP gamma 3; NBP gamma-3; guanine nucleotide-binding protein gamma-3 subunit
• Gene ID: 2785
• mRNA Refseq: NM_012202
• Protein Refseq: NP_036334
• MIM: 608941
• UniProt ID: P63215