Recombinant Full Length Human GNG3 Protein

• Cat.No.: GNG3-216HF
• Product Overview: Recombinant full length Human G gamma3 with N terminal proprietary tag; Predicted MW 33.99 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 75 amino acids
• Description: G proteins are heterotrimers of alpha, beta, and gamma subunits. Gamma subunits, such as GNG3, contribute to the specificity of the hundreds of receptor signaling pathways involving G proteins (Schwindinger et al.
• Form: Liquid
• Molecular Mass: 33.990kDa inclusive of tags
• AA Sequence: MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLVTYCDAHACEDPLITPVPTSENPFREKKFFCALL
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: GNG3 guanine nucleotide binding protein (G protein), gamma 3 [ Homo sapiens ]
• Official Symbol: GNG3
• Synonyms: GNG3; guanine nucleotide binding protein (G protein), gamma 3; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3; guanine nucleotide binding protein gamma 3 subunit; NBP gamma 3
• Gene ID: 2785
• mRNA Refseq: NM_012202
• Protein Refseq: NP_036334
• MIM: 608941
• UniProt ID: P63215