Recombinant Human GNG13 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GNG13-2629H
• Product Overview: GNG13 MS Standard C13 and N15-labeled recombinant protein (NP_057625) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: Heterotrimeric G proteins, which consist of alpha, beta, and gamma subunits, function as signal transducers for the 7-transmembrane-helix G protein-coupled receptors. GNG13 is a gamma subunit that is expressed in taste, retinal, and neuronal tissues and plays a key role in taste transduction.
• Molecular Mass: 7.9 kDa
• AA Sequence: MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTILTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GNG13 G protein subunit gamma 13 [ Homo sapiens (human) ]
• Official Symbol: GNG13
• Synonyms: GNG13; G protein subunit gamma 13; h2-35; G(gamma)13; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13; G gamma subunit, clone:h2-35; guanine nucleotide binding protein (G protein), gamma 13; guanine nucleotide binding protein 13, gamma
• Gene ID: 51764
• mRNA Refseq: NM_016541
• Protein Refseq: NP_057625
• MIM: 607298
• UniProt ID: Q9P2W3