Recombinant Human GNG10 Protein, GST-tagged

• Cat.No.: GNG10-5063H
• Product Overview: Human GNG10 full-length ORF ( NP_001017998.1, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: GNG10 (G Protein Subunit Gamma 10) is a Protein Coding gene. Among its related pathways are Aquaporin-mediated transport and Immune response CCR3 signaling in eosinophils. GO annotations related to this gene include GTPase activity and signal transducer activity. An important paralog of this gene is GNG2.
• Molecular Mass: 33.6 kDa
• AA Sequence: MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNG10 G protein subunit gamma 10 [ Homo sapiens (human) ]
• Official Symbol: GNG10
• Synonyms: GNG10 G; protein subunit gamma 10; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10; guanine nucleotide binding protein (G protein), gamma 10; guanine nucleotide binding protein 10
• Gene ID: 2790
• mRNA Refseq: NM_001017998
• Protein Refseq: NP_001017998
• MIM: 604389
• UniProt ID: P50151