Recombinant Human GNAT2 Protein, GST-tagged

• Cat.No.: GNAT2-5049H
• Product Overview: Human GNAT2 full-length ORF ( NP_005263.1, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Transducin is a 3-subunit guanine nucleotide-binding protein (G protein) which stimulates the coupling of rhodopsin and cGMP-phoshodiesterase during visual impulses. The transducin alpha subunits in rods and cones are encoded by separate genes. This gene encodes the alpha subunit in cones. [provided by RefSeq
• Molecular Mass: 66.6 kDa
• AA Sequence: MGSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEFKAIIYGNVLQSILAIIRAMTTLGIDYAEPSCADDGRQLNNLADSIEEGTMPPELVEVIRRLWKDGGVQACFERAAEYQLNDSASYYLNQLERITDPEYLPSEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYDDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNAT2 guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 [ Homo sapiens ]
• Official Symbol: GNAT2
• Synonyms: GNAT2; guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2; guanine nucleotide-binding protein G(t) subunit alpha-2; ACHM4; transducin alpha-2 chain; cone-type transducin alpha subunit; transducin, cone-specific, alpha polypeptide; GNATC
• Gene ID: 2780
• mRNA Refseq: NM_005272
• Protein Refseq: NP_005263
• MIM: 139340
• UniProt ID: P19087