Recombinant Human GNAL protein, GST-tagged

Description :	This gene encodes a stimulatory G protein alpha subunit which mediates odorant signaling in the olfactory epithelium. This protein couples dopamine type 1 receptors and adenosine A2A receptors and is widely expressed in the central nervous system. Mutations in this gene have been associated with dystonia 25 and this gene is located in a susceptibility region for bipolar disorder and schizophrenia. Alternative splicing results in multiple transcript variants.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Form :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass :	78.9 kDa
AA Sequence :	MGLCYSLRPLLFGGPGDDPCAASEPPVEDAQPAPAPALAPVRAAARDTARTLLPRGGEGSPACARPKADKPKEKR QRTEQLSAEEREAAKEREAVKEARKVSRGIDRMLRDQKRDLQQTHRLLLLGAGESGKSTIVKQMRILHVNGFNPE EKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKA CFERSNEYQLIDCAQYFLERIDSVSLVDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQ CFNDVTAIIYVAACSSYNMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDY FPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDTENIRRVFNDCRDIIQRM HLKQYELL
Applications :	Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Protein length :	1-458 a.a.

Gene Name	GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type [ Homo sapiens ]
Official Symbol	GNAL
Synonyms	GNAL; guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type; guanine nucleotide-binding protein G(olf) subunit alpha; adenylate cyclase-stimulating G alpha protein, olfactory type; guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory typ; guanine nucleotide binding protein (G protein), alpha stimulating activity polypeptide, olfactory type;
Gene ID	2774
mRNA Refseq	NM_182978
Protein Refseq	NP_892023
MIM	139312
UniProt ID	P38405
Chromosome Location	18p11.22-p11.21
Pathway	Activation of GABAB receptors, organism-specific biosystem; Adenylate cyclase activating pathway, organism-specific biosystem; Adenylate cyclase inhibitory pathway, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem;
Function	G-protein beta/gamma-subunit complex binding; G-protein coupled receptor binding; GTP binding; GTPase activity; adenylate cyclase activity; guanyl nucleotide binding; metal ion binding; nucleotide binding; signal transducer activity; signal transducer activity;