Recombinant Human GNA13 protein, GST-tagged

• Cat.No.: GNA13-27H
• Product Overview: Recombinant Human GNA13(1 a.a. - 377 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1 a.a. - 377 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 67.21 kDa
• AA Sequence: MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQD FDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIR ALWADSGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGG QRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLM LQ
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: GNA13 guanine nucleotide binding protein (G protein), alpha 13 [ Homo sapiens ]
• Official Symbol: GNA13
• Synonyms: GNA13; guanine nucleotide binding protein (G protein), alpha 13; guanine nucleotide-binding protein subunit alpha-13; G13; MGC46138; g alpha-13; G-protein subunit alpha-13
• Gene ID: 10672
• mRNA Refseq: NM_006572
• Protein Refseq: NP_006563
• MIM: 604406
• UniProt ID: Q14344
• Chromosome Location: 17q24
• Pathway: CXCR4-mediated signaling events, organism-specific biosystem; G Protein Signaling Pathways, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; G13 Signaling Pathway, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Hemostasis, organism-specific biosystem; LPA receptor mediated events, organism-specific biosystem
• Function: D5 dopamine receptor binding; G-protein beta/gamma-subunit complex binding; GTP binding; GTPase activity; guanyl nucleotide binding; metal ion binding; nucleotide binding; protein binding; signal transducer activity; type 1 angiotensin receptor binding