Recombinant Human GMPR2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GMPR2-2181H
• Product Overview: GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002001) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 37.9 kDa
• AA Sequence: MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEACTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GMPR2 guanosine monophosphate reductase 2 [ Homo sapiens (human) ]
• Official Symbol: GMPR2
• Synonyms: GMPR2; guanosine monophosphate reductase 2; GMP reductase 2; guanosine monophosphate reductase isolog; guanosine 5-monophosphate oxidoreductase 2; MGC830; MGC15084
• Gene ID: 51292
• mRNA Refseq: NM_001002001
• Protein Refseq: NP_001002001
• MIM: 610781
• UniProt ID: Q9P2T1