Recombinant Human GML Protein, GST-tagged

• Cat.No.: GML-5013H
• Product Overview: Human GML partial ORF ( NP_002057, 48 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: GML (Glycosylphosphatidylinositol Anchored Molecule Like) is a Protein Coding gene. Diseases associated with GML include Ainhum and Factor X Deficiency.
• Molecular Mass: 37.95 kDa
• AA Sequence: CPYHIRRCMTISIRINSRELLVYKNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLERDMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GML glycosylphosphatidylinositol anchored molecule like protein [ Homo sapiens ]
• Official Symbol: GML
• Synonyms: GML; glycosylphosphatidylinositol anchored molecule like protein; GPI anchored molecule like protein; glycosyl-phosphatidylinositol-anchored molecule-like protein; LY6DL; Glycosylphosphatidylinositol-anchored molecule-like protein
• Gene ID: 2765
• mRNA Refseq: NM_002066
• Protein Refseq: NP_002057
• MIM: 602370
• UniProt ID: Q99445