Recombinant Human GM2A

Description :	This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. Alternative splicing results in multiple transcript variants.
Protein length :	193 amino acids
Molecular Weight :	47.300kDa inclusive of tags
Source :	Wheat germ
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCD EGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPL KVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIP TGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELP SWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI
Tag :	Non

Gene Name	GM2A GM2 ganglioside activator [ Homo sapiens ]
Official Symbol	GM2A
Synonyms	GM2A; GM2 ganglioside activator; GM2 ganglioside activator protein; ganglioside GM2 activator; cerebroside sulfate activator protein; SAP 3; sphingolipid activator protein 3;
Gene ID	2760
mRNA Refseq	NM_000405
Protein Refseq	NP_000396
MIM	613109
Uniprot ID	P17900
Chromosome Location	5q33.1
Pathway	Lysosome, organism-specific biosystem; Lysosome, conserved biosystem;
Function	beta-N-acetylhexosaminidase activity; sphingolipid activator protein activity;