Recombinant Human GLYR1 protein, His-tagged

• Cat.No.: GLYR1-1337H
• Product Overview: Recombinant Human GLYR1 protein(133-484 aa), fused with His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 133-484 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: WQPTASEPVKDADPHFHHFLLSQTEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: GLYR1 glyoxylate reductase 1 homolog (Arabidopsis) [ Homo sapiens ]
• Official Symbol: GLYR1
• Synonyms: GLYR1; glyoxylate reductase 1 homolog (Arabidopsis); putative oxidoreductase GLYR1; BM045; HIBDL; N PAC; NP60; nuclear protein 60kDa; nuclear protein NP60; nuclear protein 60 kDa; nuclear protein of 60 kDa; cytokine-like nuclear factor n-pac; 3-hydroxyisobutyrate dehydrogenase-like protein; N-PAC
• Gene ID: 84656
• mRNA Refseq: NM_032569
• Protein Refseq: NP_115958
• MIM: 610660
• UniProt ID: Q49A26