Recombinant Human GLUD2, His-tagged
Cat.No. : | GLUD2-27654TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 229-541 of Human GLUD2 with N terminal His tag; 313 amino acids, 36kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 229-541 a.a. |
Description : | The protein encoded by this gene is localized to the mitochondrion and acts as a homohexamer to recycle glutamate during neurotransmission. The encoded enzyme catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate. This gene is intronless. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 89 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | GEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGR ISATGRGVFHGIENFINEASYMSILGMTPGFRDKTFVV QGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPK ELEDFKLQHGSILGFPKAKPYEGSILEVDCDILIPAAT EKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNI LVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDS NYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGA SEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYVN |
Gene Name | GLUD2 glutamate dehydrogenase 2 [ Homo sapiens ] |
Official Symbol | GLUD2 |
Synonyms | GLUD2; glutamate dehydrogenase 2; GLUDP1, glutamate dehydrogenase pseudogene 1; glutamate dehydrogenase 2, mitochondrial; |
Gene ID | 2747 |
mRNA Refseq | NM_012084 |
Protein Refseq | NP_036216 |
MIM | 300144 |
Uniprot ID | P49448 |
Chromosome Location | Xq24-q25 |
Pathway | Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; D-Glutamine and D-glutamate metabolism, organism-specific biosystem; |
Function | ADP binding; GTP binding; glutamate dehydrogenase (NAD+) activity; glutamate dehydrogenase [NAD(P)+] activity; leucine binding; |
◆ Recombinant Proteins | ||
GLUD2-6940HF | Recombinant Full Length Human GLUD2 Protein, GST-tagged | +Inquiry |
GLUD2-13320H | Recombinant Human GLUD2, GST-tagged | +Inquiry |
GLUD2-90H | Recombinant Human GLUD2, GST-tagged | +Inquiry |
GLUD2-89H | Recombinant Human GLUD2, GST-tagged | +Inquiry |
GLUD2-6941HF | Recombinant Full Length Human GLUD2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLUD2-716HCL | Recombinant Human GLUD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLUD2 Products
Required fields are marked with *
My Review for All GLUD2 Products
Required fields are marked with *
0
Inquiry Basket