Recombinant Full Length Human GLUD2 Protein, GST-tagged

• Cat.No.: GLUD2-6941HF
• Product Overview: Recombinant Human full-length GLUD2(1 a.a. - 264 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Description: The protein encoded by this gene is localized to the mitochondrion and acts as a homohexamer to recycle glutamate during neurotransmission. The encoded enzyme catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate. This gene is intronless.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 54.78 kDa
• Protein length: 558 amino acids
• AA Sequence: MTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEG SILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLK NLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSAR QIMHTAMKYNLGLDLRTAAYVNAIEKVFKVYSEAGVTFT
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GLUD2 glutamate dehydrogenase 2 [ Homo sapiens ]
• Official Symbol: GLUD2
• Synonyms: GLUD2; glutamate dehydrogenase 2; GLUDP1, glutamate dehydrogenase pseudogene 1; glutamate dehydrogenase 2, mitochondrial
• Gene ID: 2747
• mRNA Refseq: NM_012084
• Protein Refseq: NP_036216
• MIM: 300144
• UniProt ID: P49448