Recombinant Human GLTP Protein, GST-tagged

• Cat.No.: GLTP-4987H
• Product Overview: Human GLTP partial ORF ( NP_057517, 110 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is similar to bovine and porcine proteins which accelerate transfer of certain glycosphingolipids and glyceroglycolipids between membranes. It is thought to be a cytoplasmic protein. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: SICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIYEMYTQMNAELNYKV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GLTP glycolipid transfer protein [ Homo sapiens ]
• Official Symbol: GLTP
• Synonyms: GLTP; colipid transfer protein; glycolipid transfer protein; truncated glycolipid transfer protein
• Gene ID: 51228
• mRNA Refseq: NM_016433
• Protein Refseq: NP_057517
• MIM: 608949
• UniProt ID: Q9NZD2