Recombinant Human GLRX Protein, GST-tagged

Cat.No. : GLRX-4975H
Product Overview : Human GLRX full-length ORF ( AAH10965, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the glutaredoxin family. The encoded protein is a cytoplasmic enzyme catalyzing the reversible reduction of glutathione-protein mixed disulfides. This enzyme highly contributes to the antioxidant defense system. It is crucial for several signalling pathways by controlling the S-glutathionylation status of signalling mediators. It is involved in beta-amyloid toxicity and Alzheimer's disease. Multiple alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Aug 2011]
Molecular Mass : 37.4 kDa
AA Sequence : MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GLRX glutaredoxin (thioltransferase) [ Homo sapiens ]
Official Symbol GLRX
Synonyms GLRX; glutaredoxin (thioltransferase); glutaredoxin-1; GRX; GRX1; TTase-1; thioltransferase-1; FLJ43648; MGC117407;
Gene ID 2745
mRNA Refseq NM_001118890
Protein Refseq NP_001112362
MIM 600443
UniProt ID P35754

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GLRX Products

Required fields are marked with *

My Review for All GLRX Products

Required fields are marked with *

0

Inquiry Basket

cartIcon