Recombinant Human GLOD4 Protein, GST-tagged

• Cat.No.: GLOD4-4968H
• Product Overview: Human GLOD4 full-length ORF ( AAH15848.1, 1 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GLOD4 (Glyoxalase Domain Containing 4) is a Protein Coding gene. Diseases associated with GLOD4 include Hepatocellular Carcinoma.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 59.6 kDa
• AA Sequence: MAARRALHFVFKVGNRFQTARFYRDVLGMKVLRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEAPGGYKFYLQNRSLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKIDPEGSKLLDDAMAADKSDEWFAKHNKPKASG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GLOD4 glyoxalase domain containing 4 [ Homo sapiens ]
• Official Symbol: GLOD4
• Synonyms: GLOD4; glyoxalase domain containing 4; C17orf25, chromosome 17 open reading frame 25; glyoxalase domain-containing protein 4; CGI 150; HC71; CGI-150; C17orf25
• Gene ID: 51031
• mRNA Refseq: NM_016080
• Protein Refseq: NP_057164
• UniProt ID: Q9HC38